PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G061500.1
Common NamePHAVU_004G061500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 279aa    MW: 31538.7 Da    PI: 5.643
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G061500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF321.6e-10948140
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                        k i+n++  ++tf +R+ g++KK +E S  C+ e ++i++
  Phvul.004G061500.1  9 KHISNERSCKTTFLRRKRGLMKKVSEFSKKCGGEHCLIVY 48
                        689***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.288148IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-12181IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-4161IPR002100Transcription factor, MADS-box
PfamPF003192.7E-111150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGCARITLKH ISNERSCKTT FLRRKRGLMK KVSEFSKKCG GEHCLIVYDG GNGDVGPVTS  60
PQNPVEVHSM IQKYYESQLK NWRPHKTYGI EEFIENRKNM IEAEISRVDK QISSIKYPTW  120
DPSMINMEED QLRTFCAHVD AKIEACGKGI KLLKNKPQGF VPNMSQENTT ATTPLPNQVN  180
YLQSISQSEV LLDPVDPPLN STNELTVLEF EELIMGLSSC DWPYQACDDH VGCSSEARES  240
VLPSICDQYQ NEQQGGRDLH VLSSPLDLFQ TNYYNMFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151609.10.0hypothetical protein PHAVU_004G061500g
TrEMBLV7C2K80.0V7C2K8_PHAVU; Uncharacterized protein
STRINGGLYMA19G06145.15e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.17e-14M-type_MADS family protein